30-MINUTE MEALS! Get the email series now

Creamy Cottage Cheese Mushroom Soup

5 from 1 vote
1 Comments
Mr. Cooks
By: Mr. CooksUpdated: Mar 6, 2026
This post may contain affiliate links. Please read our disclosure policy.

A silky, savory mushroom soup enriched with cottage cheese for creamy texture without heavy cream—simple, comforting, and perfect for weeknight dinners.

Creamy Cottage Cheese Mushroom Soup

This soup has been one of my favorite weeknight comforts for years. I first came across the idea of using cottage cheese as a creamy base on a blustery autumn evening when I wanted something velvety without pulling out cream or a long list of ingredients. The result was unexpectedly luxurious: the cottage cheese purees into a silky body while preserving a light, fresh tang that lifts the earthy mushrooms. It’s become a staple when I want something nourishing, simple, and a little bit elegant without the fuss.

What makes this dish special is the way the mushrooms caramelize and concentrate their flavor before meeting the smooth cottage cheese. The contrast between the browned mushroom edges and the creamy, slightly tangy broth creates a texture and depth you don’t get from plain cream. I love the way the kitchen smells while the mushrooms brown—garlic and butter turning into something deeply savory—and how quickly it comes together for a satisfying bowl that everyone in the family actually eats.

Why You'll Love This Recipe

  • Ready in about 35 minutes from start to finish, so it’s perfect for busy weeknights when you want comfort fast.
  • Uses pantry and fridge staples—butter, onion, garlic, mixed mushrooms, and cottage cheese—no cream required.
  • Cottage cheese gives a creamy texture with more protein and less heaviness than heavy cream, making it feel lighter but still indulgent.
  • Flexible and forgiving: use whatever mushrooms are available (cremini, shiitake, button) and swap herbs easily.
  • Make-ahead friendly: flavors deepen if you simmer and cool, then reheat gently; freezes well for up to 3 months.
  • Crowd-pleasing for family dinners, yet elegant enough to serve to guests as a starter.

From the first time this appeared on our table my family took to it—my partner loved the creamy mouthfeel and my eldest declared it “better than canned soup.” I discovered the technique of partial blending to keep some mushroom texture after a curious experiment when I blended it too much and missed the bite. Now I intentionally pulse the soup so each spoonful has both silk and chew.

Ingredients

  • Butter (2 tablespoons): Use unsalted butter so you control salt; it browns beautifully and helps the mushrooms caramelize—Plugrá or Land O Lakes perform reliably.
  • Yellow onion (1 large, diced): Provides sweet aromatic foundation; choose a firm onion with dry skin and dice uniformly for even cooking.
  • Garlic (3 cloves, minced): Fresh garlic gives brightness—mince finely and add with the onion so it softens but doesn’t burn.
  • Mixed mushrooms (1 pound, sliced): A mix of cremini, shiitake, and button yields complexity—wipe mushrooms clean and slice evenly for consistent browning.
  • Low-sodium vegetable broth (4 cups): Low-sodium allows you to adjust seasoning precisely; use a quality brand like Pacific Foods or homemade for best flavor.
  • Cottage cheese (1 cup, full-fat preferred): Full-fat yields creamier texture; if large-curd, briefly pulse before adding for smoother results.
  • Thyme (1 teaspoon dried or 1 tablespoon fresh): Thyme pairs perfectly with mushrooms—fresh brightens, dried provides subtle background note.
  • Salt and pepper: Start with 1/2 teaspoon salt and 1/4 teaspoon cracked black pepper, then adjust after blending.
  • Fresh parsley (2 tablespoons, chopped): Adds color and fresh herbal lift as a garnish just before serving.

Instructions

Heat the base:Set a large, heavy-bottomed pot over medium heat and melt 2 tablespoons butter until foaming. Add the diced onion and cook 4–5 minutes, stirring occasionally, until translucent and soft but not browned; add the minced garlic in the last minute to release aroma without burning.Brown the mushrooms:Add 1 pound of sliced mixed mushrooms and increase heat to medium-high. Cook 8–12 minutes, stirring occasionally, until the mushrooms release their liquid and that liquid evaporates, and the edges begin to turn golden-brown. This Maillard browning concentrates flavor—resist crowding the pan and allow good contact with the pot base.Add liquid and herbs:Pour in 4 cups low-sodium vegetable broth and stir in 1 teaspoon dried or 1 tablespoon fresh thyme. Bring to a rolling boil, then reduce to medium-low and simmer uncovered for 15 minutes to concentrate and marry flavors; skim any foam for a clearer broth.Partially blend for texture:Remove the pot from heat and let cool 2–3 minutes. Use an immersion blender and pulse 4–6 times to break down some of the mushrooms while keeping chunks for texture. Aim for a mixed consistency—silky base with mushroom pieces.Finish with cottage cheese and season:Add 1 cup full-fat cottage cheese and blend 30–45 seconds until fully smooth and creamy. Return to low heat briefly if needed to warm through (do not boil hard once dairy is added). Season with 1/2 teaspoon salt and 1/4 teaspoon freshly cracked black pepper; taste and adjust. Ladle into bowls and garnish with 2 tablespoons chopped parsley.Bowl of creamy mushroom soup with parsley garnish

You Must Know

  • This keeps well refrigerated for 3–4 days and freezes for up to 3 months—cool fully before freezing in airtight containers.
  • Using low-sodium broth lets you control the final salt level; adjust after the cottage cheese is blended in.
  • Full-fat cottage cheese purees to a richer mouthfeel; low-fat versions will be thinner and tangier.
  • Partially blending preserves mushroom texture; fully puréeing makes a velouté-style finish.
  • Reheat gently over low heat to avoid curdling; if necessary, whisk in a splash of broth to loosen texture.

My favorite thing about this soup is the interplay between browned mushroom bits and the silk of blended cottage cheese—each spoonful offers contrast. Once, I served this at a small dinner party and two guests asked for the recipe immediately; they thought the base was a secret mix of cream and stock. The cottage cheese trick gives you that luxurious feel without heavy cream, and the recipe is forgiving enough that you can adapt it depending on what mushrooms or herbs you have on hand.

Storage Tips

Store leftovers in airtight containers in the refrigerator for up to 4 days—mason jars or shallow plastic containers work best for quick cooling. To freeze, portion into labeled freezer-safe containers leaving about 1/2 inch headspace; it will keep quality for 2–3 months. Thaw overnight in the fridge, then reheat gently over low heat, stirring often. If the texture separates slightly after freezing, whisk in a splash of broth while reheating and gently blend to restore creaminess. Avoid boiling once dairy is present to prevent curdling.

Ingredient Substitutions

If you don’t have cottage cheese, full-fat Greek yogurt is the closest substitute for creaminess—stir in off-heat to avoid splitting. For a dairy-free version, use plain unsweetened silken tofu blended until smooth or an oat-based cream alternative; flavor will be milder. Swap thyme for oregano or a pinch of rosemary for a different aromatic profile. If mushrooms are limited, use 1 pound cremini for depth, or add a few dried porcini rehydrated in warm water for an umami boost—reserve soaking liquid, strain, and add to the broth sparingly.

Serving Suggestions

Serve the soup with crusty bread like a baguette or a slice of sourdough toasted with garlic butter. A simple green salad with a tangy vinaigrette balances the creamy bowl. Garnish ideas: a drizzle of extra-virgin olive oil, a few sautéed mushroom slices, or toasted pepitas for crunch. For a heartier meal, pair with roasted root vegetables or a warm grain salad; for a starter, offer small bowls alongside a main roast or pasta.

Sliced mushrooms and ingredients on a cutting board

Cultural Background

Mushroom soups have long been a part of European and Eastern cuisines, from French veloutés to Central European broths enriched with dairy. This version adapts that tradition by replacing heavy cream with cottage cheese to modernize the profile—cottage cheese was popularized in home cooking as a high-protein, economical dairy option. Using mixed mushrooms nods to rustic mushroom stews while the light, blended finish recalls French techniques for creamy soups without thickening flours or roux.

Seasonal Adaptations

In autumn, use wild mushrooms like chanterelles or morels for a celebratory bowl—reduce quantities and simmer gently to preserve delicate flavors. Winter calls for sturdier cremini and shiitake with a splash of fortified wine for depth. Spring and summer versions can include ramps or a few young morels and finish with tarragon instead of thyme. For holiday gatherings, garnish with toasted hazelnuts and thyme sprigs to make the dish feel festive.

Meal Prep Tips

For efficient meal prep, roast a double batch of mushrooms and freeze in portioned bags—then combine with warm broth and cottage cheese to speed assembly. Chop onions and mince garlic ahead and store in sealed containers up to 2 days. If freezing single portions, cool completely before sealing to avoid ice crystals. Reheat on low heat and give a quick blend to refresh the texture. This soup fits well into weekly lunches and can be portioned into microwave-safe containers for easy workday meals.

Comfort on a spoon is just a blend away—give this a try and make it your own by adjusting herbs, mushroom mix, and garnish. It’s reliable, simple, and full of honest flavors that remind me of quiet dinners and big, welcoming bowls shared with friends.

Pro Tips

  • Brown mushrooms in batches if your pot is crowded—crowding causes steaming instead of browning.

  • Use full-fat cottage cheese for the creamiest texture; if using small-curd, briefly pulse before adding.

  • Do not boil aggressively once dairy is added; heat gently to prevent separation.

  • For extra umami, add a tablespoon of soy sauce or a few soaked porcini mushrooms' soaking liquid.

This nourishing creamy cottage cheese mushroom soup recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

FAQs about Recipes

Why is my soup grainy after adding cottage cheese?

If the soup looks grainy after blending cottage cheese, blend a little longer or strain before serving. Reheating gently while whisking helps smooth texture.

Can I freeze this soup?

Yes. Cool completely, transfer to airtight containers and freeze up to 3 months. Thaw overnight in the fridge and reheat slowly on low heat.

Tags

Quick & Easy Recipessoupcreamy-soupvegetarianweeknight-mealrecipemushrooms
No ratings yet

Creamy Cottage Cheese Mushroom Soup

This Creamy Cottage Cheese Mushroom Soup recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 4 steaks
Creamy Cottage Cheese Mushroom Soup
Prep:15 minutes
Cook:35 minutes
Rest Time:10 mins
Total:50 minutes

Instructions

1

Heat the base

Melt 2 tablespoons unsalted butter in a large heavy-bottomed pot over medium heat until foaming. Add diced onion and cook 4–5 minutes until translucent; add minced garlic in the last minute to soften without browning.

2

Brown the mushrooms

Add 1 pound sliced mixed mushrooms and increase heat to medium-high. Cook 8–12 minutes, stirring occasionally, until liquid releases and evaporates and edges turn golden-brown. Leave space to allow caramelization.

3

Simmer with broth and thyme

Pour in 4 cups low-sodium vegetable broth and add 1 teaspoon dried or 1 tablespoon fresh thyme. Bring to a boil, then reduce to medium-low and simmer uncovered for 15 minutes to concentrate flavors.

4

Partially blend for texture

Remove from heat and cool 2–3 minutes. Use an immersion blender and pulse 4–6 times to partially break down mushrooms, retaining some chunks for texture.

5

Finish with cottage cheese and season

Add 1 cup full-fat cottage cheese and blend 30–45 seconds until smooth and creamy. Warm gently if needed, season with 1/2 teaspoon salt and 1/4 teaspoon cracked black pepper, taste and adjust. Serve garnished with 2 tablespoons chopped parsley.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 180kcal | Carbohydrates: 8g | Protein:
10g | Fat: 12g | Saturated Fat: 4g |
Polyunsaturated Fat: 2g | Monounsaturated Fat:
5g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@mrcooks on social media!

Creamy Cottage Cheese Mushroom Soup

Categories:

Creamy Cottage Cheese Mushroom Soup

Did You Make This?

Leave a comment & rating below or tag @mrcooks on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Mr.!

Chef and recipe creator specializing in delicious Quick & Easy Recipes cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.